Details of the Target
General Information of Target
| Target ID | LDTP01027 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription factor MafK (MAFK) | |||||
| Gene Name | MAFK | |||||
| Gene ID | 7975 | |||||
| Synonyms |
Transcription factor MafK; Erythroid transcription factor NF-E2 p18 subunit |
|||||
| 3D Structure | ||||||
| Sequence |
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLK
NRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFART VARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, Maf subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they act as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1/NRF1, NFE2L2/NRF2 and NFE2L3/NRF3, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K110(4.83) | LDD0277 | [1] | |
|
IPM Probe Info |
 |
N.A. | LDD0241 | [2] | |
|
IA-alkyne Probe Info |
 |
C68(6.34) | LDD0371 | [3] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0222 | [4] | |
|
Crotonaldehyde Probe Info |
 |
N.A. | LDD0219 | [4] | |
|
Methacrolein Probe Info |
 |
N.A. | LDD0218 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References