Details of the Target
General Information of Target
| Target ID | LDTP00938 | |||||
|---|---|---|---|---|---|---|
| Target Name | NUAK family SNF1-like kinase 1 (NUAK1) | |||||
| Gene Name | NUAK1 | |||||
| Gene ID | 9891 | |||||
| Synonyms |
ARK5; KIAA0537; OMPHK1; NUAK family SNF1-like kinase 1; EC 2.7.11.1; AMPK-related protein kinase 5; ARK5; Omphalocele kinase 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQET
LGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYE VFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLK LENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALG VLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNPDRRATIEDI ANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEV MLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYS SPERSESSELLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPAL VSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRS CVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKL N |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Serine/threonine-protein kinase involved in various processes such as cell adhesion, regulation of cell ploidy and senescence, cell proliferation and tumor progression. Phosphorylates ATM, CASP6, LATS1, PPP1R12A and p53/TP53. Acts as a regulator of cellular senescence and cellular ploidy by mediating phosphorylation of 'Ser-464' of LATS1, thereby controlling its stability. Controls cell adhesion by regulating activity of the myosin protein phosphatase 1 (PP1) complex. Acts by mediating phosphorylation of PPP1R12A subunit of myosin PP1: phosphorylated PPP1R12A then interacts with 14-3-3, leading to reduced dephosphorylation of myosin MLC2 by myosin PP1. May be involved in DNA damage response: phosphorylates p53/TP53 at 'Ser-15' and 'Ser-392' and is recruited to the CDKN1A/WAF1 promoter to participate in transcription activation by p53/TP53. May also act as a tumor malignancy-associated factor by promoting tumor invasion and metastasis under regulation and phosphorylation by AKT1. Suppresses Fas-induced apoptosis by mediating phosphorylation of CASP6, thereby suppressing the activation of the caspase and the subsequent cleavage of CFLAR. Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with STK11, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C519(1.28) | LDD3338 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0369 | CL100 | HEK-293T | C519(0.94) | LDD1573 | [2] |
| LDCM0373 | CL104 | HEK-293T | C519(0.90) | LDD1577 | [2] |
| LDCM0377 | CL108 | HEK-293T | C519(1.05) | LDD1581 | [2] |
| LDCM0382 | CL112 | HEK-293T | C519(0.87) | LDD1586 | [2] |
| LDCM0386 | CL116 | HEK-293T | C519(1.16) | LDD1590 | [2] |
| LDCM0391 | CL120 | HEK-293T | C519(0.98) | LDD1595 | [2] |
| LDCM0395 | CL124 | HEK-293T | C519(0.99) | LDD1599 | [2] |
| LDCM0399 | CL128 | HEK-293T | C519(0.98) | LDD1603 | [2] |
| LDCM0403 | CL16 | HEK-293T | C519(0.92) | LDD1607 | [2] |
| LDCM0416 | CL28 | HEK-293T | C519(1.08) | LDD1620 | [2] |
| LDCM0429 | CL4 | HEK-293T | C519(1.21) | LDD1633 | [2] |
| LDCM0430 | CL40 | HEK-293T | C519(1.13) | LDD1634 | [2] |
| LDCM0443 | CL52 | HEK-293T | C519(0.92) | LDD1646 | [2] |
| LDCM0456 | CL64 | HEK-293T | C519(0.94) | LDD1659 | [2] |
| LDCM0469 | CL76 | HEK-293T | C519(1.17) | LDD1672 | [2] |
| LDCM0482 | CL88 | HEK-293T | C519(0.87) | LDD1685 | [2] |
| LDCM0022 | KB02 | EFO-21 | C519(2.45) | LDD2321 | [1] |
| LDCM0023 | KB03 | EFO-21 | C519(2.08) | LDD2738 | [1] |
| LDCM0024 | KB05 | MV4-11 | C519(1.28) | LDD3338 | [1] |
References

