Details of the Target
General Information of Target
| Target ID | LDTP00860 | |||||
|---|---|---|---|---|---|---|
| Target Name | Synaptogyrin-3 (SYNGR3) | |||||
| Gene Name | SYNGR3 | |||||
| Gene ID | 9143 | |||||
| Synonyms |
Synaptogyrin-3 |
|||||
| 3D Structure | ||||||
| Sequence |
MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCV
FNGNAGACRFGVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWF VGFCFLTNQWQRTAPGPATTQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLF ATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVPAY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Synaptogyrin family
|
|||||
| Subcellular location |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane
|
|||||
| Function |
May play a role in regulated exocytosis. May indirectly regulate the activity of the plasma membrane dopamine transporter SLC6A3 and thereby regulate dopamine transport back from the synaptic cleft into the presynaptic terminal.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
2.52 | LDD2182 | [1] | |
|
DBIA Probe Info |
![]() |
C59(1.01) | LDD1512 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0259 | AC14 | HEK-293T | C59(1.01) | LDD1512 | [2] |
| LDCM0282 | AC22 | HEK-293T | C59(0.99) | LDD1521 | [2] |
| LDCM0291 | AC30 | HEK-293T | C59(0.98) | LDD1530 | [2] |
| LDCM0299 | AC38 | HEK-293T | C59(0.99) | LDD1538 | [2] |
| LDCM0308 | AC46 | HEK-293T | C59(1.02) | LDD1547 | [2] |
| LDCM0317 | AC54 | HEK-293T | C59(0.99) | LDD1556 | [2] |
| LDCM0323 | AC6 | HEK-293T | C59(0.99) | LDD1562 | [2] |
| LDCM0326 | AC62 | HEK-293T | C59(1.04) | LDD1565 | [2] |
| LDCM0368 | CL10 | HEK-293T | C59(1.10) | LDD1572 | [2] |
| LDCM0410 | CL22 | HEK-293T | C59(0.96) | LDD1614 | [2] |
| LDCM0423 | CL34 | HEK-293T | C59(1.10) | LDD1627 | [2] |
| LDCM0436 | CL46 | HEK-293T | C59(0.92) | LDD1640 | [2] |
| LDCM0449 | CL58 | HEK-293T | C59(0.97) | LDD1652 | [2] |
| LDCM0463 | CL70 | HEK-293T | C59(0.96) | LDD1666 | [2] |
| LDCM0476 | CL82 | HEK-293T | C59(1.03) | LDD1679 | [2] |
| LDCM0489 | CL94 | HEK-293T | C59(0.99) | LDD1692 | [2] |
| LDCM0582 | Fragment23 | Ramos | 0.78 | LDD2196 | [1] |
| LDCM0578 | Fragment27 | Ramos | 1.52 | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | 1.73 | LDD2198 | [1] |
| LDCM0022 | KB02 | Ramos | 2.52 | LDD2182 | [1] |
References


