Details of the Target
General Information of Target
Target ID | LDTP00848 | |||||
---|---|---|---|---|---|---|
Target Name | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial (GATC) | |||||
Gene Name | GATC | |||||
Gene ID | 283459 | |||||
Synonyms |
15E1.2; Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; Glu-AdT subunit C; EC 6.3.5.-; Protein 15E1.2 |
|||||
3D Structure | ||||||
Sequence |
MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKA
IAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPG NISLPKLDEQEPFPHS |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
GatC family
|
|||||
Subcellular location |
Mitochondrion
|
|||||
Function |
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). {|HAMAP-Rule:MF_03149}.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
IPM Probe Info |
![]() |
N.A. | LDD0241 | [2] | |
DBIA Probe Info |
![]() |
C99(2.04) | LDD3323 | [3] | |
IA-alkyne Probe Info |
![]() |
C99(0.64) | LDD2182 | [4] | |
JW-RF-010 Probe Info |
![]() |
N.A. | LDD0026 | [5] | |
Phosphinate-6 Probe Info |
![]() |
C99(0.00); C86(0.00) | LDD0018 | [6] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [7] | |
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [7] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0156 | Aniline | NCI-H1299 | 13.37 | LDD0403 | [1] |
LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [7] |
LDCM0625 | F8 | Ramos | C99(1.29) | LDD2187 | [4] |
LDCM0572 | Fragment10 | Ramos | C99(0.45) | LDD2189 | [4] |
LDCM0573 | Fragment11 | Ramos | C99(0.24) | LDD2190 | [4] |
LDCM0574 | Fragment12 | Ramos | C99(0.66) | LDD2191 | [4] |
LDCM0575 | Fragment13 | Ramos | C99(0.87) | LDD2192 | [4] |
LDCM0576 | Fragment14 | Ramos | C99(0.87) | LDD2193 | [4] |
LDCM0579 | Fragment20 | Ramos | C99(0.73) | LDD2194 | [4] |
LDCM0580 | Fragment21 | Ramos | C99(1.17) | LDD2195 | [4] |
LDCM0582 | Fragment23 | Ramos | C99(1.34) | LDD2196 | [4] |
LDCM0578 | Fragment27 | Ramos | C99(0.91) | LDD2197 | [4] |
LDCM0586 | Fragment28 | Ramos | C99(0.61) | LDD2198 | [4] |
LDCM0588 | Fragment30 | Ramos | C99(1.01) | LDD2199 | [4] |
LDCM0589 | Fragment31 | Ramos | C99(0.82) | LDD2200 | [4] |
LDCM0590 | Fragment32 | Ramos | C99(0.40) | LDD2201 | [4] |
LDCM0468 | Fragment33 | Ramos | C99(0.57) | LDD2202 | [4] |
LDCM0596 | Fragment38 | Ramos | C99(0.97) | LDD2203 | [4] |
LDCM0566 | Fragment4 | Ramos | C99(0.95) | LDD2184 | [4] |
LDCM0610 | Fragment52 | Ramos | C99(0.92) | LDD2204 | [4] |
LDCM0614 | Fragment56 | Ramos | C99(1.18) | LDD2205 | [4] |
LDCM0569 | Fragment7 | Ramos | C99(0.66) | LDD2186 | [4] |
LDCM0571 | Fragment9 | Ramos | C99(0.59) | LDD2188 | [4] |
LDCM0022 | KB02 | Ramos | C99(0.64) | LDD2182 | [4] |
LDCM0023 | KB03 | Ramos | C99(0.82) | LDD2183 | [4] |
LDCM0024 | KB05 | SKMEL24 | C99(2.04) | LDD3323 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial (QRSL1) | Amidase family | Q9H0R6 | |||
Polyunsaturated fatty acid 5-lipoxygenase (ALOX5) | Lipoxygenase family | P09917 |
Other
References