Details of the Target
General Information of Target
| Target ID | LDTP00847 | |||||
|---|---|---|---|---|---|---|
| Target Name | TP53-regulated inhibitor of apoptosis 1 (TRIAP1) | |||||
| Gene Name | TRIAP1 | |||||
| Gene ID | 51499 | |||||
| Synonyms |
15E1.1; TP53-regulated inhibitor of apoptosis 1; Protein 15E1.1; WF-1; p53-inducible cell-survival factor; p53CSV |
|||||
| 3D Structure | ||||||
| Sequence |
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIE
GLEFMGHGKEKPENSS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
TRIAP1/MDM35 family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function |
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
 |
C47(0.80) | LDD2101 | [1] | |
|
DBIA Probe Info |
 |
C18(1.65); C47(2.08) | LDD0080 | [2] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0175 | [3] | |
|
IPM Probe Info |
 |
C18(0.00); C47(0.00) | LDD2156 | [4] | |
|
NAIA_5 Probe Info |
 |
C18(0.00); C37(0.00); C8(0.00); C47(0.00) | LDD2223 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | HCT 116 | C18(1.65); C47(2.08) | LDD0080 | [2] |
| LDCM0023 | KB03 | HCT 116 | C18(1.43); C47(1.45) | LDD0081 | [2] |
| LDCM0024 | KB05 | HCT 116 | C18(2.24); C47(1.70) | LDD0082 | [2] |
| LDCM0508 | Nucleophilic fragment 17a | MDA-MB-231 | C47(0.80) | LDD2101 | [1] |
| LDCM0540 | Nucleophilic fragment 35 | MDA-MB-231 | C47(0.49) | LDD2133 | [1] |
| LDCM0554 | Nucleophilic fragment 7a | MDA-MB-231 | C47(0.41) | LDD2148 | [1] |
The Interaction Atlas With This Target
References