Details of the Target
General Information of Target
| Target ID | LDTP00839 | |||||
|---|---|---|---|---|---|---|
| Target Name | A-kinase anchor protein 7 isoforms alpha and beta (AKAP7) | |||||
| Gene Name | AKAP7 | |||||
| Gene ID | 9465 | |||||
| Synonyms |
AKAP15; AKAP18; A-kinase anchor protein 7 isoforms alpha and beta; AKAP-7 isoforms alpha and beta; A-kinase anchor protein 18 kDa; AKAP 18; Protein kinase A-anchoring protein 7 isoforms alpha/beta; PRKA7 isoforms alpha/beta
|
|||||
| 3D Structure | ||||||
| Sequence |
MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLV
ENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Lipid-anchor; Apical cell membrane; Lateral cell membrane
|
|||||
| Function |
Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. The membrane-associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic form may negatively regulate ENaC channel feedback inhibition by intracellular sodium.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-4 Probe Info |
 |
100.00 | LDD0445 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Other