Details of the Target
General Information of Target
| Target ID | LDTP00823 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein SNAI2 (SNAI2) |
|
||||
| Gene Name | SNAI2 | |||||
| Gene ID | 6591 | |||||
| Synonyms |
SLUG; SLUGH; Zinc finger protein SNAI2; Neural crest transcription factor Slug; Protein snail homolog 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK YQCKNCSKTFSRMSLLHKHEESGCCVAH |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Snail C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C151(1.86) | LDD3353 | [1] | |
|
Phosphinate-6 Probe Info |
 |
N.A. | LDD0018 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0369 | CL100 | HEK-293T | C151(0.77) | LDD1573 | [3] |
| LDCM0373 | CL104 | HEK-293T | C151(0.73) | LDD1577 | [3] |
| LDCM0377 | CL108 | HEK-293T | C151(0.64) | LDD1581 | [3] |
| LDCM0382 | CL112 | HEK-293T | C151(0.69) | LDD1586 | [3] |
| LDCM0386 | CL116 | HEK-293T | C151(0.81) | LDD1590 | [3] |
| LDCM0391 | CL120 | HEK-293T | C151(0.74) | LDD1595 | [3] |
| LDCM0395 | CL124 | HEK-293T | C151(0.56) | LDD1599 | [3] |
| LDCM0399 | CL128 | HEK-293T | C151(0.93) | LDD1603 | [3] |
| LDCM0403 | CL16 | HEK-293T | C151(0.86) | LDD1607 | [3] |
| LDCM0416 | CL28 | HEK-293T | C151(0.85) | LDD1620 | [3] |
| LDCM0429 | CL4 | HEK-293T | C151(1.24) | LDD1633 | [3] |
| LDCM0430 | CL40 | HEK-293T | C151(0.95) | LDD1634 | [3] |
| LDCM0443 | CL52 | HEK-293T | C151(0.85) | LDD1646 | [3] |
| LDCM0456 | CL64 | HEK-293T | C151(0.79) | LDD1659 | [3] |
| LDCM0469 | CL76 | HEK-293T | C151(0.84) | LDD1672 | [3] |
| LDCM0482 | CL88 | HEK-293T | C151(1.06) | LDD1685 | [3] |
| LDCM0022 | KB02 | 42-MG-BA | C151(2.24) | LDD2244 | [1] |
| LDCM0023 | KB03 | 42-MG-BA | C151(1.84) | LDD2661 | [1] |
| LDCM0024 | KB05 | NCI-H2052 | C151(1.86) | LDD3353 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger protein 76 (ZNF76) | Krueppel C2H2-type zinc-finger protein family | P36508 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Calcium-binding protein 2 (CABP2) | . | Q9NPB3 | |||
References