Details of the Target
General Information of Target
| Target ID | LDTP00809 | |||||
|---|---|---|---|---|---|---|
| Target Name | Proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1) | |||||
| Gene Name | PSTPIP1 | |||||
| Gene ID | 9051 | |||||
| Synonyms |
CD2BP1; Proline-serine-threonine phosphatase-interacting protein 1; PEST phosphatase-interacting protein 1; CD2-binding protein 1; H-PIP |
|||||
| 3D Structure | ||||||
| Sequence |
MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYE AVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQC KDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSM QCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPG IQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASP AQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Involved in regulation of the actin cytoskeleton. May regulate WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allow PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T-cell:APC contact site so as to promote the actin polymerization required for synapse induction during T-cell activation. Down-regulates CD2-stimulated adhesion through the coupling of PTPN12 to CD2. Also has a role in innate immunity and the inflammatory response. Recruited to inflammasomes by MEFV. Induces formation of pyroptosomes, large supramolecular structures composed of oligomerized PYCARD dimers which form prior to inflammatory apoptosis. Binding to MEFV allows MEFV to bind to PYCARD and facilitates pyroptosome formation. Regulates endocytosis and cell migration in neutrophils.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C13(1.28); C305(2.75); C259(0.90) | LDD2412 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C305(5.88) | LDD0514 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0202 | EV-93 | T cell | C305(5.88) | LDD0514 | [2] |
| LDCM0022 | KB02 | Karpas-299 | C13(1.28); C305(2.75); C259(0.90) | LDD2412 | [1] |
| LDCM0023 | KB03 | Karpas-299 | C13(2.02); C305(2.42); C259(1.24) | LDD2829 | [1] |
| LDCM0024 | KB05 | Karpas-299 | C13(1.99); C305(3.71); C259(0.92) | LDD3246 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Hyaluronan and proteoglycan link protein 2 (HAPLN2) | HAPLN family | Q9GZV7 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Tumor necrosis factor ligand superfamily member 6 (FASLG) | Tumor necrosis factor family | P48023 | |||
Other
References


