Details of the Target

General Information of Target

Target ID LDTP00809
Target Name Proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1)
Gene Name PSTPIP1
Gene ID 9051
Synonyms
CD2BP1; Proline-serine-threonine phosphatase-interacting protein 1; PEST phosphatase-interacting protein 1; CD2-binding protein 1; H-PIP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQC
KDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSM
QCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPG
IQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASP
AQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Involved in regulation of the actin cytoskeleton. May regulate WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allow PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T-cell:APC contact site so as to promote the actin polymerization required for synapse induction during T-cell activation. Down-regulates CD2-stimulated adhesion through the coupling of PTPN12 to CD2. Also has a role in innate immunity and the inflammatory response. Recruited to inflammasomes by MEFV. Induces formation of pyroptosomes, large supramolecular structures composed of oligomerized PYCARD dimers which form prior to inflammatory apoptosis. Binding to MEFV allows MEFV to bind to PYCARD and facilitates pyroptosome formation. Regulates endocytosis and cell migration in neutrophils.
Uniprot ID
O43586
Ensemble ID
ENST00000558012.6
HGNC ID
HGNC:9580

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
8505C SNV: p.E101G .
COLO792 SNV: p.E339D .
GB1 SNV: p.Y345C .
Ishikawa (Heraklio) 02 ER SNV: p.M2L .
LNCaP clone FGC SNV: p.L231M .
NCIH2172 Substitution: p.R253G .
TE4 SNV: p.E56K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C13(1.28); C305(2.75); C259(0.90)  LDD2412  [1]
IA-alkyne
 Probe Info  		C305(5.88)  LDD0514  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0202  EV-93 T cell C305(5.88)  LDD0514  [2]
 LDCM0022  KB02 Karpas-299 C13(1.28); C305(2.75); C259(0.90)  LDD2412  [1]
 LDCM0023  KB03 Karpas-299 C13(2.02); C305(2.42); C259(1.24)  LDD2829  [1]
 LDCM0024  KB05 Karpas-299 C13(1.99); C305(3.71); C259(0.92)  LDD3246  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Paraplegin (SPG7) AAA ATPase family; Peptidase M41 family Q9UQ90
Tryptophan 5-hydroxylase 1 (TPH1) Biopterin-dependent aromatic amino acid hydroxylase family P17752
Probable ATP-dependent RNA helicase DHX40 (DHX40) DEAD box helicase family Q8IX18
Bifunctional polynucleotide phosphatase/kinase (PNKP) DNA 3' phosphatase family Q96T60
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Tyrosine-protein phosphatase non-receptor type 12 (PTPN12) Protein-tyrosine phosphatase family Q05209
Tyrosine-protein phosphatase non-receptor type 18 (PTPN18) Protein-tyrosine phosphatase family Q99952
Tyrosine-protein phosphatase non-receptor type 22 (PTPN22) Protein-tyrosine phosphatase family Q9Y2R2
Ubiquitin-conjugating enzyme E2 W (UBE2W) Ubiquitin-conjugating enzyme family Q96B02
Pyrin (MEFV) . O15553
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear cap-binding protein subunit 1 (NCBP1) NCBP1 family Q09161
RNA-binding protein with serine-rich domain 1 (RNPS1) Splicing factor SR family Q15287
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 175 (ZNF175) Krueppel C2H2-type zinc-finger protein family Q9Y473
Hematopoietically-expressed homeobox protein HHEX (HHEX) . Q03014
Zinc finger protein 408 (ZNF408) . Q9H9D4
Zinc finger protein 580 (ZNF580) . Q9UK33
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor ligand superfamily member 6 (FASLG) Tumor necrosis factor family P48023
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
U6 snRNA-associated Sm-like protein LSm4 (LSM4) SnRNP Sm proteins family Q9Y4Z0
Tubby-related protein 3 (TULP3) TUB family O75386
Large ribosomal subunit protein uL6 (RPL9; RPL9P7; RPL9P8; RPL9P9) Universal ribosomal protein uL6 family P32969
Mitotic checkpoint protein BUB3 (BUB3) WD repeat BUB3 family O43684
Axin-1 (AXIN1) . O15169
Heat shock factor 2-binding protein (HSF2BP) . O75031
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Microspherule protein 1 (MCRS1) . Q96EZ8
Proline-rich protein 35 (PRR35) . P0CG20
Proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1) . O43586
Protein lin-37 homolog (LIN37) . Q96GY3
Protocadherin beta-14 (PCDHB14) . Q9Y5E9
Receptor-transporting protein 5 (RTP5) . Q14D33
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
TRAF3-interacting JNK-activating modulator (TRAF3IP3) . Q9Y228

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.