Details of the Target

General Information of Target

Target ID LDTP00788
Target Name WAS/WASL-interacting protein family member 1 (WIPF1)
Gene Name WIPF1
Gene ID 7456
Synonyms
WASPIP; WIP; WAS/WASL-interacting protein family member 1; Protein PRPL-2; Wiskott-Aldrich syndrome protein-interacting protein; WASP-interacting protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDND
SGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKP
DSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGNRGTALGGGSIRQSPL
SSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRP
SASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPP
PSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLA
RNESRSGSNRRERGAPPLPPIPR
Target Bioclass
Other
Family
Verprolin family
Subcellular location
Cytoplasmic vesicle
Function
Plays a role in the reorganization of the actin cytoskeleton. Contributes with NCK1 and GRB2 in the recruitment and activation of WASL. May participate in regulating the subcellular localization of WASL, resulting in the disassembly of stress fibers in favor of filopodia formation. Plays a role in the formation of cell ruffles. Plays an important role in the intracellular motility of vaccinia virus by functioning as an adapter for recruiting WASL to vaccinia virus.
Uniprot ID
O43516
Ensemble ID
ENST00000272746.9
HGNC ID
HGNC:12736

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
ECC2 SNV: p.A427V .
IGROV1 SNV: p.P414T .
JURKAT Deletion: p.P162QfsTer79 .
KMCH1 Deletion: p.G64EfsTer48
SNV: p.Q336E		 .
LNCaP clone FGC SNV: p.E492G .
MEWO SNV: p.P151S .
MFE296 SNV: p.S477G .
NCIH2172 SNV: p.D261H .
OZ SNV: p.L252V .
RKO Deletion: p.P360RfsTer10 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C446(1.13)  LDD0304  [1]
Methacrolein
 Probe Info  		N.A.  LDD0218  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C446(1.35)  LDD2187  [3]
 LDCM0572  Fragment10 Ramos C446(0.88)  LDD2189  [3]
 LDCM0573  Fragment11 Ramos C446(0.47)  LDD2190  [3]
 LDCM0574  Fragment12 Ramos C446(0.73)  LDD2191  [3]
 LDCM0575  Fragment13 Ramos C446(0.78)  LDD2192  [3]
 LDCM0576  Fragment14 Ramos C446(0.93)  LDD2193  [3]
 LDCM0579  Fragment20 Ramos C446(0.56)  LDD2194  [3]
 LDCM0580  Fragment21 Ramos C446(0.75)  LDD2195  [3]
 LDCM0582  Fragment23 Ramos C446(0.67)  LDD2196  [3]
 LDCM0578  Fragment27 Ramos C446(0.77)  LDD2197  [3]
 LDCM0586  Fragment28 Ramos C446(0.75)  LDD2198  [3]
 LDCM0588  Fragment30 Ramos C446(0.98)  LDD2199  [3]
 LDCM0589  Fragment31 Ramos C446(0.68)  LDD2200  [3]
 LDCM0590  Fragment32 Ramos C446(0.97)  LDD2201  [3]
 LDCM0468  Fragment33 Ramos C446(0.87)  LDD2202  [3]
 LDCM0596  Fragment38 Ramos C446(0.48)  LDD2203  [3]
 LDCM0566  Fragment4 Ramos C446(0.69)  LDD2184  [3]
 LDCM0610  Fragment52 Ramos C446(0.80)  LDD2204  [3]
 LDCM0614  Fragment56 Ramos C446(0.98)  LDD2205  [3]
 LDCM0569  Fragment7 Ramos C446(0.67)  LDD2186  [3]
 LDCM0571  Fragment9 Ramos C446(0.75)  LDD2188  [3]
 LDCM0022  KB02 Ramos C446(1.04)  LDD2182  [3]
 LDCM0023  KB03 Ramos C446(0.71)  LDD2183  [3]
 LDCM0024  KB05 Ramos C446(0.69)  LDD2185  [3]
 LDCM0131  RA190 MM1.R C446(1.13)  LDD0304  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-aminolevulinate synthase, non-specific, mitochondrial (ALAS1) Class-II pyridoxal-phosphate-dependent aminotransferase family P13196
Fas-activated serine/threonine kinase (FASTK) FAST protein kinase family Q14296
Tyrosine-protein kinase HCK (HCK) Tyr protein kinase family P08631
NEDD4-like E3 ubiquitin-protein ligase WWP2 (WWP2) . O00308
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Voltage-dependent calcium channel gamma-2 subunit (CACNG2) PMP-22/EMP/MP20 family Q9Y698
Protein RER1 (RER1) RER1 family O15258
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Abl interactor 2 (ABI2) ABI family Q9NYB9
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Homer protein homolog 3 (HOMER3) Homer family Q9NSC5
Protein transport protein Sec24C (SEC24C) SEC23/SEC24 family P53992
Actin nucleation-promoting factor WAS (WAS) . P42768
Actin nucleation-promoting factor WASL (WASL) . O00401
Cytoplasmic protein NCK2 (NCK2) . O43639
Hematopoietic lineage cell-specific protein (HCLS1) . P14317
SH2/SH3 adapter protein NCK1 (NCK1) . P16333

References

1 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578