Details of the Target
General Information of Target
Target ID | LDTP00646 | |||||
---|---|---|---|---|---|---|
Target Name | Alpha-2,8-sialyltransferase 8E (ST8SIA5) | |||||
Gene Name | ST8SIA5 | |||||
Gene ID | 29906 | |||||
Synonyms |
SIAT8E; Alpha-2,8-sialyltransferase 8E; EC 2.4.99.-; Sialyltransferase 8E; SIAT8-E; Sialyltransferase St8Sia V; ST8SiaV |
|||||
3D Structure | ||||||
Sequence |
MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRC
LELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTT QKNTPLGTKLKYEVDTSGIYHINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGR EINSADFVFRCNLPPISEKYTMDVGVKTDVVTVNPSIITERFHKLEKWRRPFYRVLQVYE NASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQYLVNVSRYWLSLGVRAKRIS TGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAMPSEIFNFLHL HSRGILRVHTGTCSCC |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Glycosyltransferase 29 family
|
|||||
Subcellular location |
Golgi apparatus membrane
|
|||||
Function | Involved in the synthesis of gangliosides GD1c, GT1a, GQ1b, GP1c and GT3 from GD1a, GT1b, GM1b and GD3 respectively. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C164(1.42) | LDD2182 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C164(0.89) | LDD2187 | [1] |
LDCM0572 | Fragment10 | Ramos | C164(0.45) | LDD2189 | [1] |
LDCM0573 | Fragment11 | Ramos | C164(0.02) | LDD2190 | [1] |
LDCM0574 | Fragment12 | Ramos | C164(0.43) | LDD2191 | [1] |
LDCM0575 | Fragment13 | Ramos | C164(1.31) | LDD2192 | [1] |
LDCM0576 | Fragment14 | Ramos | C164(1.20) | LDD2193 | [1] |
LDCM0579 | Fragment20 | Ramos | C164(0.64) | LDD2194 | [1] |
LDCM0580 | Fragment21 | Ramos | C164(0.67) | LDD2195 | [1] |
LDCM0582 | Fragment23 | Ramos | C164(0.97) | LDD2196 | [1] |
LDCM0578 | Fragment27 | Ramos | C164(0.81) | LDD2197 | [1] |
LDCM0586 | Fragment28 | Ramos | C164(0.45) | LDD2198 | [1] |
LDCM0588 | Fragment30 | Ramos | C164(0.66) | LDD2199 | [1] |
LDCM0589 | Fragment31 | Ramos | C164(1.18) | LDD2200 | [1] |
LDCM0590 | Fragment32 | Ramos | C164(0.62) | LDD2201 | [1] |
LDCM0468 | Fragment33 | Ramos | C164(1.07) | LDD2202 | [1] |
LDCM0596 | Fragment38 | Ramos | C164(0.63) | LDD2203 | [1] |
LDCM0566 | Fragment4 | Ramos | C164(0.53) | LDD2184 | [1] |
LDCM0610 | Fragment52 | Ramos | C164(1.17) | LDD2204 | [1] |
LDCM0614 | Fragment56 | Ramos | C164(1.02) | LDD2205 | [1] |
LDCM0569 | Fragment7 | Ramos | C164(1.16) | LDD2186 | [1] |
LDCM0571 | Fragment9 | Ramos | C164(0.61) | LDD2188 | [1] |
LDCM0022 | KB02 | Ramos | C164(1.42) | LDD2182 | [1] |
LDCM0023 | KB03 | Ramos | C164(1.99) | LDD2183 | [1] |
LDCM0024 | KB05 | Ramos | C164(1.42) | LDD2185 | [1] |