Details of the Target
General Information of Target
| Target ID | LDTP00594 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitogen-activated protein kinase 13 (MAPK13) | |||||
| Gene Name | MAPK13 | |||||
| Gene ID | 5603 | |||||
| Synonyms |
PRKM13; SAPK4; Mitogen-activated protein kinase 13; MAP kinase 13; MAPK 13; EC 2.7.11.24; Mitogen-activated protein kinase p38 delta; MAP kinase p38 delta; Stress-activated protein kinase 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR SGMKL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
|
|||||
| Function |
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as pro-inflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| 22RV1 | SNV: p.L130R | . | |||
| HCC1937 | SNV: p.E316Ter | DBIA Probe Info | |||
| HEPG2 | Deletion: p.L297PfsTer7 | . | |||
| IGR37 | SNV: p.I235M | . | |||
| IGR39 | SNV: p.I235M | . | |||
| LNCaP clone FGC | SNV: p.H81N | . | |||
| MOLT4 | SNV: p.A52V | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K226(10.00); K256(0.46); K268(10.00); K344(0.88) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C165(1.27) | LDD3312 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C162(0.00); C40(0.00) | LDD0162 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [5] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Serine/threonine-protein kinase D1 (PRKD1) | CAMK Ser/Thr protein kinase family | Q15139 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Signal transducer and activator of transcription 3 (STAT3) | Transcription factor STAT family | P40763 | |||
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| fMet-Leu-Phe receptor (FPR1) | G-protein coupled receptor 1 family | P21462 | |||
References





