General Information of Target

Target ID LDTP00556
Target Name Zinc finger and BTB domain-containing protein 7B (ZBTB7B)
Gene Name ZBTB7B
Gene ID 51043
Synonyms
ZBTB15; ZFP67; ZNF857B; Zinc finger and BTB domain-containing protein 7B; Krueppel-related zinc finger protein cKrox; hcKrox; T-helper-inducing POZ/Krueppel-like factor; Zinc finger and BTB domain-containing protein 15; Zinc finger protein 67 homolog; Zfp-67; Zinc finger protein 857B; Zinc finger protein Th-POK
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDS
PPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAG
RVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP
EELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGK
LPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNH
MHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAS
PAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Exerts distinct biological functions in the mammary epithelial cells and T cells in a tissue-specific manner. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Cross-antagonism between ZBTB7B and CBF complexes are determinative to CD4 versus CD8 cell fate decision. Suppresses RUNX3 expression and imposes CD4+ lineage fate by inducing the SOCS suppressors of cytokine signaling. induces, as a transcriptional activator, SOCS genes expression which represses RUNX3 expression and promotes the CD4+ lineage fate. During CD4 lineage commitment, associates with multiple sites at the CD8 locus, acting as a negative regulator of the CD8 promoter and enhancers by epigenetic silencing through the recruitment of class II histone deacetylases, such as HDAC4 and HDAC5, to these loci. Regulates the development of IL17-producing CD1d-restricted naural killer (NK) T cells. Also functions as an important metabolic regulator in the lactating mammary glands. Critical feed-forward regulator of insulin signaling in mammary gland lactation, directly regulates expression of insulin receptor substrate-1 (IRS-1) and insulin-induced Akt-mTOR-SREBP signaling. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes. Potent driver of brown fat development, thermogenesis and cold-induced beige fat formation. Recruits the brown fat lncRNA 1 (Blnc1):HNRNPU ribonucleoprotein complex to activate thermogenic gene expression in brown and beige adipocytes.
Uniprot ID
O15156
Ensemble ID
ENST00000292176.2
HGNC ID
HGNC:18668

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C89(1.77); C488(0.88)  LDD3312  [1]
IPM
 Probe Info 
N.A.  LDD0025  [2]
TFBX
 Probe Info 
N.A.  LDD0148  [2]
Acrolein
 Probe Info 
N.A.  LDD0217  [3]
NAIA_5
 Probe Info 
N.A.  LDD2223  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C55(1.24)  LDD1512  [5]
 LDCM0282  AC22 HEK-293T C55(1.04)  LDD1521  [5]
 LDCM0291  AC30 HEK-293T C55(1.01)  LDD1530  [5]
 LDCM0299  AC38 HEK-293T C55(1.21)  LDD1538  [5]
 LDCM0308  AC46 HEK-293T C55(1.44)  LDD1547  [5]
 LDCM0317  AC54 HEK-293T C55(1.25)  LDD1556  [5]
 LDCM0323  AC6 HEK-293T C55(1.10)  LDD1562  [5]
 LDCM0326  AC62 HEK-293T C55(1.05)  LDD1565  [5]
 LDCM0632  CL-Sc Hep-G2 C55(1.93)  LDD2227  [4]
 LDCM0368  CL10 HEK-293T C55(1.42)  LDD1572  [5]
 LDCM0410  CL22 HEK-293T C55(1.35)  LDD1614  [5]
 LDCM0423  CL34 HEK-293T C55(1.40)  LDD1627  [5]
 LDCM0436  CL46 HEK-293T C55(1.35)  LDD1640  [5]
 LDCM0449  CL58 HEK-293T C55(1.48)  LDD1652  [5]
 LDCM0463  CL70 HEK-293T C55(1.22)  LDD1666  [5]
 LDCM0476  CL82 HEK-293T C55(1.13)  LDD1679  [5]
 LDCM0489  CL94 HEK-293T C55(0.96)  LDD1692  [5]
 LDCM0022  KB02 22RV1 C89(1.87)  LDD2243  [1]
 LDCM0023  KB03 22RV1 C89(2.87)  LDD2660  [1]
 LDCM0024  KB05 HMCB C89(1.77); C488(0.88)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Prolyl 4-hydroxylase subunit alpha-3 (P4HA3) P4HA family Q7Z4N8
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Synaptotagmin-like protein 4 (SYTL4) . Q96C24
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
B-cell lymphoma 6 protein (BCL6) . P41182
Upstream-binding factor 1-like protein 1 (UBTFL1) . P0CB47
Zinc finger and BTB domain-containing protein 5 (ZBTB5) . O15062
Zinc finger and SCAN domain-containing protein 5B (ZSCAN5B) . A6NJL1
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
SH3 domain-containing YSC84-like protein 1 (SH3YL1) SH3YL1 family Q96HL8
Large ribosomal subunit protein uL6 (RPL9; RPL9P7; RPL9P8; RPL9P9) Universal ribosomal protein uL6 family P32969
Cytoplasmic protein NCK2 (NCK2) . O43639
Mortality factor 4-like protein 2 (MORF4L2) . Q15014
SH3 domain-containing kinase-binding protein 1 (SH3KBP1) . Q96B97
U3 small nucleolar ribonucleoprotein protein IMP4 (IMP4) . Q96G21
Vinexin (SORBS3) . O60504

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402