Details of the Target
General Information of Target
| Target ID | LDTP00295 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 593 (ZNF593) | |||||
| Gene Name | ZNF593 | |||||
| Gene ID | 51042 | |||||
| Synonyms |
ZT86; Zinc finger protein 593; Zinc finger protein T86 |
|||||
| 3D Structure | ||||||
| Sequence |
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGL
HRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVP TEVSTEVPEMDTST |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
ZNF593/BUD20 C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus, nucleolus
|
|||||
| Function |
Involved in pre-60S ribosomal particles maturation by promoting the nuclear export of the 60S ribosome. Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y97(7.56) | LDD3495 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C296 Probe Info |
![]() |
12.73 | LDD1966 | [2] | |
The Interaction Atlas With This Target
References


