Details of the Target
General Information of Target
| Target ID | LDTP00217 | |||||
|---|---|---|---|---|---|---|
| Target Name | Galectin-8 (LGALS8) | |||||
| Gene Name | LGALS8 | |||||
| Gene ID | 3964 | |||||
| Synonyms |
Galectin-8; Gal-8; Po66 carbohydrate-binding protein; Po66-CBP; Prostate carcinoma tumor antigen 1; PCTA-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRA
DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSI DTLEINGDIHLLEVRSW |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasmic vesicle
|
|||||
| Function |
Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY4 Probe Info |
![]() |
N.A. | LDD0247 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Calreticulin (CALR) | Calreticulin family | P27797 | |||
| Wolframin (WFS1) | . | O76024 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein TGIF1 (TGIF1) | TALE/TGIF homeobox family | Q15583 | |||
| Nucleus accumbens-associated protein 1 (NACC1) | . | Q96RE7 | |||
Other

