Details of the Target

General Information of Target

Target ID LDTP00030
Target Name Myelin-associated neurite-outgrowth inhibitor (FAM168B)
Gene Name FAM168B
Gene ID 130074
Synonyms
KIAA0280L; MANI; Myelin-associated neurite-outgrowth inhibitor; Mani; p20
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYK
VSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTT
VVQPNGMPATVYPAPIPPPRGNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTY
RAPGTPTYSYVPPQW
Target Bioclass
Other
Family
FAM168 family
Subcellular location
Cytoplasm, perinuclear region
Function Inhibitor of neuronal axonal outgrowth. Acts as a negative regulator of CDC42 and STAT3 and a positive regulator of STMN2. Positive regulator of CDC27.
Uniprot ID
A1KXE4
Ensemble ID
ENST00000389915.4
HGNC ID
HGNC:27016

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
MEWO SNV: p.G141S .
MFE319 SNV: p.A158T .
MM1S SNV: p.K60T .
RKO Deletion: p.Q93SfsTer70 .
TOV21G SNV: p.L161M .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C63(1.66)  LDD2182  [1]
TFBX
 Probe Info  		N.A.  LDD0027  [2]
IPM
 Probe Info  		N.A.  LDD0147  [2]
m-APA
 Probe Info  		N.A.  LDD0404  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 N.A.  LDD0404  [3]
 LDCM0630  CCW28-3 231MFP C63(2.19)  LDD2214  [4]
 LDCM0625  F8 Ramos C63(0.91)  LDD2187  [1]
 LDCM0572  Fragment10 Ramos C63(1.67)  LDD2189  [1]
 LDCM0574  Fragment12 Ramos C63(0.70)  LDD2191  [1]
 LDCM0575  Fragment13 Ramos C63(0.79)  LDD2192  [1]
 LDCM0576  Fragment14 Ramos C63(1.52)  LDD2193  [1]
 LDCM0579  Fragment20 Ramos C63(0.70)  LDD2194  [1]
 LDCM0580  Fragment21 Ramos C63(0.54)  LDD2195  [1]
 LDCM0582  Fragment23 Ramos C63(0.98)  LDD2196  [1]
 LDCM0578  Fragment27 Ramos C63(0.82)  LDD2197  [1]
 LDCM0586  Fragment28 Ramos C63(0.96)  LDD2198  [1]
 LDCM0588  Fragment30 Ramos C63(0.91)  LDD2199  [1]
 LDCM0589  Fragment31 Ramos C63(0.62)  LDD2200  [1]
 LDCM0590  Fragment32 Ramos C63(1.35)  LDD2201  [1]
 LDCM0468  Fragment33 Ramos C63(1.28)  LDD2202  [1]
 LDCM0596  Fragment38 Ramos C63(0.56)  LDD2203  [1]
 LDCM0566  Fragment4 Ramos C63(2.88)  LDD2184  [1]
 LDCM0610  Fragment52 Ramos C63(0.93)  LDD2204  [1]
 LDCM0614  Fragment56 Ramos C63(1.08)  LDD2205  [1]
 LDCM0569  Fragment7 Ramos C63(1.96)  LDD2186  [1]
 LDCM0571  Fragment9 Ramos C63(1.02)  LDD2188  [1]
 LDCM0022  KB02 Ramos C63(1.66)  LDD2182  [1]
 LDCM0023  KB03 Ramos C63(0.99)  LDD2183  [1]
 LDCM0024  KB05 Ramos C63(1.93)  LDD2185  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alanine--glyoxylate aminotransferase (AGXT) Class-V pyridoxal-phosphate-dependent aminotransferase family P21549
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Tyrosine-protein kinase transmembrane receptor ROR2 (ROR2) Tyr protein kinase family Q01974
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
Prolyl hydroxylase EGLN3 (EGLN3) . Q9H6Z9
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Transcription factor
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B9 (HOXB9) Abd-B homeobox family P17482
Zinc finger protein GLIS2 (GLIS2) GLI C2H2-type zinc-finger protein family Q9BZE0
Zinc finger protein ZIC 1 (ZIC1) GLI C2H2-type zinc-finger protein family Q15915
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
Homeobox protein OTX1 (OTX1) Paired homeobox family P32242
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
Rhox homeobox family member 2 (RHOXF2) Paired-like homeobox family Q9BQY4
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Forkhead box protein H1 (FOXH1) . O75593
Homeobox protein VENTX (VENTX) . O95231
Pogo transposable element with ZNF domain (POGZ) . Q7Z3K3
T-cell leukemia homeobox protein 3 (TLX3) . O43711
Other
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM222B (FAM222B) FAM222 family Q8WU58
Mediator of RNA polymerase II transcription subunit 25 (MED25) Mediator complex subunit 25 family Q71SY5
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
U1 small nuclear ribonucleoprotein C (SNRPC) U1 small nuclear ribonucleoprotein C family P09234
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
BAG family molecular chaperone regulator 3 (BAG3) . O95817
Cleavage stimulation factor subunit 2 (CSTF2) . P33240
Cleavage stimulation factor subunit 2 tau variant (CSTF2T) . Q9H0L4
G protein pathway suppressor 2 (GPS2) . Q13227
Proline-rich protein 35 (PRR35) . P0CG20
Sterile alpha motif domain-containing protein 7 (SAMD7) . Q7Z3H4
Ubiquitin-associated protein 2 (UBAP2) . Q5T6F2
Zinc finger CCCH domain-containing protein 10 (ZC3H10) . Q96K80

References

1 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
4 Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications. ACS Chem Biol. 2019 Nov 15;14(11):2430-2440. doi: 10.1021/acschembio.8b01083. Epub 2019 May 13.