Details of the Target
General Information of Target
| Target ID | LDTP20419 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative uncharacterized protein encoded by LINC00312 (LINC00312) | |||||
| Gene Name | LINC00312 | |||||
| Synonyms |
LOH3CR2A; NCRNA00312; Putative uncharacterized protein encoded by LINC00312; Loss of heterozygosity 3 chromosomal region 2 gene A protein |
|||||
| 3D Structure | ||||||
| Sequence |
MSLLWTPQILTISFVSYILSLFPSPFPSCYTSCWFETSITTEKELNQYFELAKFLA
|
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C604(0.00); C568(0.00); C521(0.00); C76(0.00) | LDD0161 | [1] | |

