Details of the Target
General Information of Target
| Target ID | LDTP20418 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative TAP2-associated 6.5 kDa polypeptide | |||||
| Synonyms |
Putative TAP2-associated 6.5 kDa polypeptide |
|||||
| 3D Structure | ||||||
| Sequence |
MGMALELYWLCGFRSYWPLGTNAENEGNRKENRRQMQSRNERGCNVRQTKTYRDREADRH
IHGIACLLF |
|||||
| Target Bioclass |
Other
|
|||||
| Function | May be associated with TAP2 isoform activity. | |||||
| Uniprot ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C1434(0.00); C1023(0.00); C286(0.00); C88(0.00) | LDD0161 | [1] | |