Details of the Target
General Information of Target
| Target ID | LDTP20410 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative uncharacterized protein DHRS4-AS1 (DHRS4-AS1) | |||||
| Gene Name | DHRS4-AS1 | |||||
| Synonyms |
C14orf167; Putative uncharacterized protein DHRS4-AS1; DHRS4 antisense RNA 1; DHRS4 antisense gene protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MMITRGWEGWGRRGARGAGTGTGLGGPGTPESSVTPPEFPLPPATRITPNFPNTLDPAIS
RSSS |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C1323(0.00); C1216(0.00); C933(0.00); C892(0.00) | LDD0161 | [1] | |

