Details of the Target
General Information of Target
| Target ID | LDTP20395 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative uncharacterized protein encoded by LINC00597 (LINC00597) | |||||
| Gene Name | LINC00597 | |||||
| Synonyms |
C15orf5; Putative uncharacterized protein encoded by LINC00597 |
|||||
| 3D Structure | ||||||
| Sequence |
MPSCSCALMAPCGPAAGPAAVERTQQVARGEPGSARGQLQVSPEMSITHKEKENAHLKEI
LLFVNAEAFSQPQPHSAPVCEGQQLTGKFSTSVLTRAGGDASPCSWERLLCYGWSHC |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
C55(0.00); C57(0.00) | LDD0241 | [1] | |