Details of the Target
General Information of Target
| Target ID | LDTP20208 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane protein 276 (TMEM276) | |||||
| Gene Name | TMEM276 | |||||
| Gene ID | 84773 | |||||
| Synonyms |
Transmembrane protein 276 |
|||||
| 3D Structure | ||||||
| Sequence |
MDLGSGSSQGGDLETTFQLWLQLLLWAHLAVRFLGYLHRTFRGPKPQPAP
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
 |
N.A. | LDD0027 | [1] | |