Details of the Target
General Information of Target
| Target ID | LDTP20199 | |||||
|---|---|---|---|---|---|---|
| Target Name | Small integral membrane protein 10-like protein 2A (SMIM10L2A) | |||||
| Gene Name | SMIM10L2A | |||||
| Gene ID | 399668 | |||||
| Synonyms |
LINC00086; NCRNA00086; Small integral membrane protein 10-like protein 2A |
|||||
| 3D Structure | ||||||
| Sequence |
MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVIL
NIRLQVHI |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
 |
N.A. | LDD0148 | [1] | |