Details of the Target
General Information of Target
| Target ID | LDTP20187 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein FAM200B (FAM200B) | |||||
| Gene Name | FAM200B | |||||
| Gene ID | 285550 | |||||
| Synonyms |
C4orf53; Protein FAM200B |
|||||
| 3D Structure | ||||||
| Sequence |
MHVCDLQKLVRIQLAFTTFPWMFSCHLLPTPELSSKRNQCLLYKTSGCLTQMPILYGHPA
TLLKDYILQAILQPGKKIQGGTEIQRGSFANQYQTDASHL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
FAM200 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
N.A. | LDD0241 | [1] | |