Details of the Target
General Information of Target
| Target ID | LDTP20169 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein C3orf84 (C3orf84) | |||||
| Gene Name | C3orf84 | |||||
| Gene ID | 646498 | |||||
| Synonyms |
Uncharacterized protein C3orf84 |
|||||
| 3D Structure | ||||||
| Sequence |
MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGK
KGRSK |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C46(1.49) | LDD1702 | [1] | |
Competitor(s) Related to This Target

