Details of the Target
General Information of Target
| Target ID | LDTP20091 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thrombospondin type-1 domain-containing protein 8 (THSD8) | |||||
| Gene Name | THSD8 | |||||
| Synonyms |
Thrombospondin type-1 domain-containing protein 8 |
|||||
| 3D Structure | ||||||
| Sequence |
MARAPQPRRGPAAPGNALRALLRCNLPPGAQRVVVSAVLALLVLINVVLIFLLAFR
|
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [1] | |
Competitor(s) Related to This Target

