Details of the Target
General Information of Target
| Target ID | LDTP20075 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein SPMIP1 (SPMIP1) | |||||
| Gene Name | SPMIP1 | |||||
| Gene ID | 100130705 | |||||
| Synonyms |
ATP6V1FNB; Protein SPMIP1; ATP6V1F neighbor gene protein; Protein ATP6V1FNB; Sperm-associated microtubule inner protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MGLKGAWCFPWCGCRRQRGTERGAGLSPAAPPDPSPAIAPTMAEGGVPSPGPGAYFSRKA
RLSFRHQLHDIASANDSTI |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C367(5.27) | LDD3310 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [2] | |
Competitor(s) Related to This Target
References


