Details of the Target | Chem(Pro)²

General Information of Target

Target ID	LDTP20062
Target Name	Small integral membrane protein 28 (SMIM28)
Gene Name	SMIM28
Synonyms	Small integral membrane protein 28
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MEEPTPEPVYVDVDKGLTLACFVFLCLFLVVMIIRCAKVIMDPYSAIPTSTWEEQHLDD
Target Bioclass	Other
Subcellular location	Membrane
Uniprot ID	A0A1B0GU29
Ensemble ID	ENST00000573100.2
HGNC ID	HGNC:53434

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
Acrolein Probe Info			N.A.	LDD0230	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0109	NEM	HeLa	N.A.	LDD0230	[1]

References

1	ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.