Details of the Target
General Information of Target
| Target ID | LDTP20020 | |||||
|---|---|---|---|---|---|---|
| Target Name | SS18-like protein 2 (SS18L2) | |||||
| Gene Name | SS18L2 | |||||
| Gene ID | 51188 | |||||
| Synonyms |
SS18-like protein 2; SYT homolog 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MRQRGQEHLPTSVKSEPRACNNPTVAENRRVPSGLAAVIRNLTALWNPSLGVSERRGGDW
EPSRIPRLWARVGWIQLPG |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SS18 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C34(3.36) | LDD3352 | [1] | |
|
TFBX Probe Info |
 |
N.A. | LDD0027 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| ER membrane protein complex subunit 2 (EMC2) | EMC2 family | Q15006 | |||
| Transmembrane protein 17 (TMEM17) | TMEM17 family | Q86X19 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 (GNG3) | G protein gamma family | P63215 | |||
| Ly6/PLAUR domain-containing protein 6 (LYPD6) | . | Q86Y78 | |||
References