Details of the Target
General Information of Target
| Target ID | LDTP20017 | |||||
|---|---|---|---|---|---|---|
| Target Name | G antigen 2D (GAGE2D; GAGE8) | |||||
| Gene Name | GAGE2D; GAGE8 | |||||
| Gene ID | 100101629 | |||||
| Synonyms |
; G antigen 2D; GAGE-2D; Cancer/testis antigen 4.8; CT4.8; G antigen 8; GAGE-8 |
|||||
| 3D Structure | ||||||
| Sequence |
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRP
HRTQGAGSPPETNEKLTNPQVKEK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GAGE family
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-475 Probe Info |
![]() |
Y16(1.07) | LDD0264 | [1] | |
Competitor(s) Related to This Target

