Details of the Target
General Information of Target
| Target ID | LDTP19985 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein C11orf16 (C11orf16) | |||||
| Gene Name | C11orf16 | |||||
| Gene ID | 56673 | |||||
| Synonyms |
Uncharacterized protein C11orf16 |
|||||
| 3D Structure | ||||||
| Sequence |
MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAANGQGQPEDPPRSSNDAVL
LWIAIIATLGNIVVVGVVYAFTF |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [1] | |

