Details of the Target
General Information of Target
| Target ID | LDTP19960 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative testis-specific Y-encoded-like protein 3 (TSPY26P) | |||||
| Gene Name | TSPY26P | |||||
| Synonyms |
TSPYL3; Putative testis-specific Y-encoded-like protein 3; TSPY-like protein 3; Testis-specific Y-encoded protein 26 pseudogene |
|||||
| 3D Structure | ||||||
| Sequence |
MGRKWSGPTAEHQLPMPPPGVRLDSWKGVASGCSPSKASQEARGKEKCPTLNGQPQWSAL
FTLPPQRE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Nucleosome assembly protein (NAP) family
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C82(1.69) | LDD3436 | [1] | |
Competitor(s) Related to This Target