Details of the Target
General Information of Target
| Target ID | LDTP19944 | |||||
|---|---|---|---|---|---|---|
| Target Name | Normal mucosa of esophagus-specific gene 1 protein (NMES1) | |||||
| Gene Name | NMES1 | |||||
| Gene ID | 84419 | |||||
| Synonyms |
C15orf48; Normal mucosa of esophagus-specific gene 1 protein; Protein FOAP-11 |
|||||
| 3D Structure | ||||||
| Sequence |
MVRHPYSVQTQLSTEAKAIWRSMQQQETNLLANLTTNDARDNSKDFQNSKVGAAATSRDE
GCNCPIIGEIVISCYWLFEIPPLISE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Complex I NDUFA4 subunit family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K46(6.67); K70(6.39); K9(5.96) | LDD0277 | [1] | |

