Details of the Target
General Information of Target
| Target ID | LDTP19873 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane protein 141 (TMEM141) | |||||
| Gene Name | TMEM141 | |||||
| Gene ID | 85014 | |||||
| Synonyms |
Transmembrane protein 141 |
|||||
| 3D Structure | ||||||
| Sequence |
MGRADTPRHPPPPAAGFGVHRGAFLIPVALRVLLAGRTPRPFTPGLADPRRLGPRRVQAA
Q |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TMEM141 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [1] | |

