Details of the Target
General Information of Target
| Target ID | LDTP19837 | |||||
|---|---|---|---|---|---|---|
| Target Name | Pancreatic progenitor cell differentiation and proliferation factor-like protein (PPDPFL) | |||||
| Gene Name | PPDPFL | |||||
| Gene ID | 492307 | |||||
| Synonyms |
C8orf22; Pancreatic progenitor cell differentiation and proliferation factor-like protein; Exocrine differentiation and proliferation factor-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MSWRGRRYRPRRCLRLAQLVGPMLEPSVPEPQQEEPPTESQDHTPGQKREDDQGAAEIQV
PNLEADLQELSQSKTGDECGDSPDVQGKILPKSEQFKMPEGGEGKPQL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
PPDPF family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
C9(2.20) | LDD1701 | [1] | |
Competitor(s) Related to This Target