Details of the Target
General Information of Target
| Target ID | LDTP19818 | |||||
|---|---|---|---|---|---|---|
| Target Name | Secretoglobin family 1C member 1 (SCGB1C1) | |||||
| Gene Name | SCGB1C1 | |||||
| Gene ID | 147199 | |||||
| Synonyms |
Secretoglobin family 1C member 1; Secretoglobin RYD5 |
|||||
| 3D Structure | ||||||
| Sequence |
MAYVFNLSCLGSQVERLLEARSSRPTWIIQPSPKKAPEACFSFHSSYERNWA
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Secretoglobin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
 |
N.A. | LDD0447 | [1] | |