Details of the Target
General Information of Target
| Target ID | LDTP19811 | |||||
|---|---|---|---|---|---|---|
| Target Name | UBA-like domain-containing protein 1 (UBALD1) | |||||
| Gene Name | UBALD1 | |||||
| Gene ID | 124402 | |||||
| Synonyms |
FAM100A; UBA-like domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLLAPPSTPSRGRTPSAVERLEADKAKYVKTHQVIARRQEPALRGSPGPLTPHPCNELGP
PASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDCKASVNKENAKGQGLVRRLFLGAPRDAA PSSPASTERPAASGGWAAPQDAPEAAGKRALCPTCSLPLSEKERFFNYCGLERALVEVLG AERFSPQSWGADASPQAGTSPPPGSGDASDWTSSDRGVDSPGGAGGGGGSEAAGSARDRR PPVSVVERNARVIQWLYGCQRARGPPRESEV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
UBALD family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C23(1.60) | LDD2182 | [1] | |
|
IPM Probe Info |
 |
N.A. | LDD2156 | [2] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0217 | [3] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [3] |
| LDCM0625 | F8 | Ramos | C23(2.34) | LDD2187 | [1] |
| LDCM0573 | Fragment11 | Ramos | C23(0.80) | LDD2190 | [1] |
| LDCM0576 | Fragment14 | Ramos | C23(1.12) | LDD2193 | [1] |
| LDCM0566 | Fragment4 | Ramos | C23(1.47) | LDD2184 | [1] |
| LDCM0569 | Fragment7 | Ramos | C23(1.43) | LDD2186 | [1] |
| LDCM0022 | KB02 | Ramos | C23(1.60) | LDD2182 | [1] |
| LDCM0024 | KB05 | Ramos | C23(2.00) | LDD2185 | [1] |
References