Details of the Target
General Information of Target
| Target ID | LDTP19767 | |||||
|---|---|---|---|---|---|---|
| Target Name | Kelch repeat and BTB domain-containing protein 3 (KBTBD3) | |||||
| Gene Name | KBTBD3 | |||||
| Gene ID | 143879 | |||||
| Synonyms |
BKLHD3; Kelch repeat and BTB domain-containing protein 3; BTB and kelch domain-containing protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MELQGAQEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGH
QQELRDWNLGEDASLLFSKSPFGAGKLIQAPAHVFRQCWVQGNAWISCITKFDSKRSPEV ASSPSYLTVPRRSPLPVFLRPSDRCVCGGCYLGKSTRRRACQSLLSDPLGVTFPTQTRP |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C350(1.11) | LDD2268 | [1] | |
Competitor(s) Related to This Target