Details of the Target
General Information of Target
| Target ID | LDTP19707 | |||||
|---|---|---|---|---|---|---|
| Target Name | Calcium homeostasis modulator protein 5 (CALHM5) | |||||
| Gene Name | CALHM5 | |||||
| Gene ID | 254228 | |||||
| Synonyms |
C6orf188; FAM26E; Calcium homeostasis modulator protein 5; Protein FAM26E |
|||||
| 3D Structure | ||||||
| Sequence |
MSEAKDNGSRDEVLVPHKNCRKNTTVPGKKGEEKSLAPVFAEKLISPSRRGAKLKDRESH
QENEDRNSELDQDEEDKESFCRGFPMSGCELETSCCVCHSTALGERFC |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
CALHM family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Pore-forming subunit of a voltage-gated ion channel. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [1] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [1] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [1] | |
Competitor(s) Related to This Target



