Details of the Target
General Information of Target
| Target ID | LDTP19483 | |||||
|---|---|---|---|---|---|---|
| Target Name | Epididymal-specific lipocalin-12 (LCN12) | |||||
| Gene Name | LCN12 | |||||
| Gene ID | 286256 | |||||
| Synonyms |
Epididymal-specific lipocalin-12 |
|||||
| 3D Structure | ||||||
| Sequence |
MALNNVSLSSGDQRSRVAYRSSHGDLRPRASALAMVSGDGFLVSRPEAIHLGPRQAVRPS
VRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVLQQRLIALGGVIAAR ISV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Calycin superfamily, Lipocalin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Binds all-trans retinoic acid and may act as a retinoid carrier protein within the epididymis. May play a role in male fertility. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C165(1.10) | LDD2090 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [2] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0548 | 1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one | MDA-MB-231 | C165(0.85) | LDD2142 | [1] |
| LDCM0519 | 1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one | MDA-MB-231 | C165(0.94) | LDD2112 | [1] |
| LDCM0524 | 2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide | MDA-MB-231 | C165(1.28) | LDD2117 | [1] |
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [2] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [2] |
| LDCM0497 | Nucleophilic fragment 11b | MDA-MB-231 | C165(1.10) | LDD2090 | [1] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C165(0.86) | LDD2092 | [1] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C165(1.20) | LDD2098 | [1] |
| LDCM0507 | Nucleophilic fragment 16b | MDA-MB-231 | C165(0.99) | LDD2100 | [1] |
| LDCM0511 | Nucleophilic fragment 18b | MDA-MB-231 | C165(0.86) | LDD2104 | [1] |
| LDCM0512 | Nucleophilic fragment 19a | MDA-MB-231 | C165(1.07) | LDD2105 | [1] |
| LDCM0521 | Nucleophilic fragment 23b | MDA-MB-231 | C165(0.85) | LDD2114 | [1] |
| LDCM0522 | Nucleophilic fragment 24a | MDA-MB-231 | C165(0.68) | LDD2115 | [1] |
| LDCM0541 | Nucleophilic fragment 36 | MDA-MB-231 | C165(1.16) | LDD2134 | [1] |
| LDCM0544 | Nucleophilic fragment 39 | MDA-MB-231 | C165(0.93) | LDD2137 | [1] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C165(0.74) | LDD2141 | [1] |
References



