Details of the Target
General Information of Target
| Target ID | LDTP19435 | |||||
|---|---|---|---|---|---|---|
| Target Name | DDB1- and CUL4-associated factor 12-like protein 1 (DCAF12L1) | |||||
| Gene Name | DCAF12L1 | |||||
| Gene ID | 139170 | |||||
| Synonyms |
WDR40B; DDB1- and CUL4-associated factor 12-like protein 1; WD repeat-containing protein 40B |
|||||
| 3D Structure | ||||||
| Sequence |
MSVEKMTKVEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELA
LAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKAFYVERF |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
WD repeat DCAF12 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C113(2.00) | LDD3352 | [1] | |
Competitor(s) Related to This Target

