Details of the Target
General Information of Target
| Target ID | LDTP19327 | |||||
|---|---|---|---|---|---|---|
| Target Name | Oxidoreductase-like domain-containing protein 1 (OXLD1) | |||||
| Gene Name | OXLD1 | |||||
| Gene ID | 339229 | |||||
| Synonyms |
C17orf90; Oxidoreductase-like domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSSHKTFKIKQFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWKRTKLGL
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0227 | [1] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [2] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [3] | |
Competitor(s) Related to This Target
References



