Details of the Target
General Information of Target
| Target ID | LDTP19283 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative coiled-coil domain-containing protein 144B (CCDC144BP) | |||||
| Gene Name | CCDC144BP | |||||
| Synonyms |
CCDC144B; Putative coiled-coil domain-containing protein 144B; Coiled-coil domain-containing protein 144B, pseudogene |
|||||
| 3D Structure | ||||||
| Sequence |
MSFDNNYHGGQGYAKGGLGCSYGCGLSGYGYACYCPWCYERSWFSGCF
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CCDC144 family
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C388(2.77) | LDD3332 | [1] | |
Competitor(s) Related to This Target

