Details of the Target
General Information of Target
| Target ID | LDTP19254 | |||||
|---|---|---|---|---|---|---|
| Target Name | Coiled-coil domain-containing protein 27 (CCDC27) | |||||
| Gene Name | CCDC27 | |||||
| Gene ID | 148870 | |||||
| Synonyms |
Coiled-coil domain-containing protein 27 |
|||||
| 3D Structure | ||||||
| Sequence |
MGFAEAFLEHLWKNLQDPSNPAIIRQAAGNYIGSFLARAKFISLITVKPCLDLLVNWLHI
YLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYPQSLNFERIV MSQLNPLKICLPSVVNFFAAITKMKTCGYGWW |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY-1 Probe Info |
![]() |
N.A. | LDD0246 | [1] | |
The Interaction Atlas With This Target

