Details of the Target
General Information of Target
| Target ID | LDTP19189 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative uncharacterized protein encoded by BRWD1-AS2 (BRWD1-AS2) | |||||
| Gene Name | BRWD1-AS2 | |||||
| Synonyms |
BRWD1-IT2; C21orf87; NCRNA00257; Putative uncharacterized protein encoded by BRWD1-AS2; ATP1A1 antisense RNA 1; ATP1A1 antisense gene protein 1; BRWD1 intronic transcript 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MTTLSKSKQPSAAGNLDEQTPGECFCRSCFVTSSEVWKRWKHLDPACAADPWEAPTPRIE
KPDGKECLGRTSCPRLA |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C98(3.21) | LDD3373 | [1] | |
Competitor(s) Related to This Target

