Details of the Target
General Information of Target
| Target ID | LDTP19158 | |||||
|---|---|---|---|---|---|---|
| Target Name | G antigen 1 (GAGE1) | |||||
| Gene Name | GAGE1 | |||||
| Gene ID | 2543 | |||||
| Synonyms |
G antigen 1; GAGE-1; Antigen MZ2-F; Cancer/testis antigen 4.1; CT4.1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSSLQAMKTLSLVLLVALLSMERAQGLRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSV
FGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCNAVVLAASSPWALCVQ LLLSLGSVFLWALL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GAGE family
|
|||||
| Function | Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C117(1.72) | LDD3373 | [1] | |
Competitor(s) Related to This Target