Details of the Target
General Information of Target
| Target ID | LDTP19147 | |||||
|---|---|---|---|---|---|---|
| Target Name | Centromere protein V-like protein 2 (CENPVL2) | |||||
| Gene Name | CENPVL2 | |||||
| Synonyms |
CENPVP2; Centromere protein V-like protein 2; Centromere protein V pseudogene 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSS
SQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Gfa family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C281(0.67) | LDD3323 | [1] | |
Competitor(s) Related to This Target