Details of the Target
General Information of Target
| Target ID | LDTP19116 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sperm microtubule associated protein 2-like (SPMAP2L) | |||||
| Gene Name | SPMAP2L | |||||
| Gene ID | 100506564 | |||||
| Synonyms |
THEGL; Sperm microtubule associated protein 2-like; Testicular haploid expressed gene protein-like; Theg spermatid-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGS
ETEEDTSSSPHRIRSARQRRAPADEGHRPLT |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C176(0.77) | LDD2108 | [1] | |
Competitor(s) Related to This Target

