Details of the Target
General Information of Target
| Target ID | LDTP19038 | |||||
|---|---|---|---|---|---|---|
| Target Name | Coiled-coil domain-containing protein 175 (CCDC175) | |||||
| Gene Name | CCDC175 | |||||
| Gene ID | 729665 | |||||
| Synonyms |
C14orf38; Coiled-coil domain-containing protein 175 |
|||||
| 3D Structure | ||||||
| Sequence |
MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLP
IRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [1] | |
|
Cinnamaldehyde Probe Info |
![]() |
N.A. | LDD0220 | [1] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [1] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [1] | |
Competitor(s) Related to This Target




