Details of the Target
General Information of Target
| Target ID | LDTP19013 | |||||
|---|---|---|---|---|---|---|
| Target Name | Melanoma-associated antigen B3 (MAGEB3) | |||||
| Gene Name | MAGEB3 | |||||
| Gene ID | 4114 | |||||
| Synonyms |
Melanoma-associated antigen B3; MAGE-B3 antigen |
|||||
| 3D Structure | ||||||
| Sequence |
MADEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNSSSGGKIWQGEPARVRRSHL
LVKPVKAALDLAAGNHPDQGGGPGADQRLHPEDQGRREGL |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C148(1.40) | LDD3376 | [1] | |
Competitor(s) Related to This Target

