Details of the Target
General Information of Target
| Target ID | LDTP18996 | |||||
|---|---|---|---|---|---|---|
| Target Name | POTE ankyrin domain family member B2 (POTEB2) | |||||
| Gene Name | POTEB2 | |||||
| Gene ID | 100287399 | |||||
| Synonyms |
POTE ankyrin domain family member B2 |
|||||
| 3D Structure | ||||||
| Sequence |
MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIP
EPGLLWSS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
POTE family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C197(1.90) | LDD3466 | [1] | |
Competitor(s) Related to This Target

