Details of the Target
General Information of Target
| Target ID | LDTP18840 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative short-chain dehydrogenase/reductase family 42E member 2 (SDR42E2) | |||||
| Gene Name | SDR42E2 | |||||
| Synonyms |
Putative short-chain dehydrogenase/reductase family 42E member 2; EC 1.1.1.- |
|||||
| 3D Structure | ||||||
| Sequence |
MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQ
KRKKDPSS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
3-beta-HSD family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
![]() |
N.A. | LDD0273 | [1] | |

